Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.204: Ribosome binding protein Y (YfiA homologue) [69753] (1 superfamily) beta-alpha-beta(3)-alpha; 2 layers; mixed sheet 1234, strand 3 is antiparallel to the rest |
Superfamily d.204.1: Ribosome binding protein Y (YfiA homologue) [69754] (2 families) automatically mapped to Pfam PF02482 |
Family d.204.1.0: automated matches [227270] (1 protein) not a true family |
Protein automated matches [227070] (6 species) not a true protein |
Species Vibrio cholerae [TaxId:243277] [226508] (1 PDB entry) |
Domain d4heia_: 4hei A: [222553] automated match to d2ywqa1 complexed with 3co, scn, unl |
PDB Entry: 4hei (more details), 1.6 Å
SCOPe Domain Sequences for d4heia_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4heia_ d.204.1.0 (A:) automated matches {Vibrio cholerae [TaxId: 243277]} mqiniqghhidltdsmqdyvhskfdklerffdhinhvqvilrveklrqiaeatlhvnqae ihahaddenmyaaidslvdklvrqlnkhkekl
Timeline for d4heia_: