Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies) 3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest |
Superfamily c.51.4: ITPase-like [52972] (4 families) formerly Maf/Ham1; elaborated with additional structures inserted in the common fold |
Family c.51.4.2: Maf-like [52976] (3 proteins) automatically mapped to Pfam PF02545 |
Protein automated matches [227099] (1 species) not a true protein |
Species Bacillus subtilis [TaxId:1423] [226507] (1 PDB entry) |
Domain d4heba_: 4heb A: [222549] automated match to d1ex2a_ complexed with unx |
PDB Entry: 4heb (more details), 2.26 Å
SCOPe Domain Sequences for d4heba_:
Sequence, based on SEQRES records: (download)
>d4heba_ c.51.4.2 (A:) automated matches {Bacillus subtilis [TaxId: 1423]} kplilasqsprrkelldllqlpysiivseveeklnrnfspeenvqwlakqkakavadlhp haivigadtmvcldgeclgkpqdqeeaasmlrrlsgrshsvitavsiqaenhsetfydkt evafwslseeeiwtyietkepmdkagaygiqgrgalfvkkidgdyysvmglpisktmral rhf
>d4heba_ c.51.4.2 (A:) automated matches {Bacillus subtilis [TaxId: 1423]} kplilasqsprrkelldllqlpysiivseveklnrnfspeenvqwlakqkakavadlhph aivigadtmvcldgeclgkpqdqeeaasmlrrlsgrshsvitavsiqaenhsetfydkte vafwslseeeiwtyietkepmdkagaygiqgrgalfvkkidgdyysvmglpisktmralr hf
Timeline for d4heba_: