Lineage for d4he8k_ (4he8 K:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3029574Fold f.73: Non-antiporter membrane subunits from respiratory complex I [418733] (3 superfamilies)
    Three subunits form a single 11-helix bundle at the interface between the hydrophilic domain and the antiporter-like subunits
  4. 3029575Superfamily f.73.1: Respiratory complex I subunit NuoK-like [418777] (1 family) (S)
  5. 3029576Family f.73.1.1: Respiratory complex I subunit NuoK-like [418866] (2 proteins)
    Pfam PF00420
  6. 3029577Protein NADH-quinone oxidoreductase subunit K, NuoK/Nqo11 [419223] (2 species)
  7. 3029580Species Thermus thermophilus HB8 [TaxId:300852] [419746] (1 PDB entry)
  8. 3029581Domain d4he8k_: 4he8 K: [413823]
    Other proteins in same PDB: d4he8a_, d4he8c_, d4he8j_, d4he8l_, d4he8m_, d4he8n_
    complexed with umq

Details for d4he8k_

PDB Entry: 4he8 (more details), 3.3 Å

PDB Description: Crystal structure of the membrane domain of respiratory complex I from Thermus thermophilus
PDB Compounds: (K:) NADH-quinone oxidoreductase subunit 11

SCOPe Domain Sequences for d4he8k_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4he8k_ f.73.1.1 (K:) NADH-quinone oxidoreductase subunit K, NuoK/Nqo11 {Thermus thermophilus HB8 [TaxId: 300852]}
msylltsallfalgvygvltrrtailvflsielmlnaanlslvgfaraygldgqvaalmv
iavaaaevavglglivaifrhrestavddlselrg

SCOPe Domain Coordinates for d4he8k_:

Click to download the PDB-style file with coordinates for d4he8k_.
(The format of our PDB-style files is described here.)

Timeline for d4he8k_:

  • d4he8k_ is new in SCOPe 2.08-stable