Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.73: Non-antiporter membrane subunits from respiratory complex I [418733] (3 superfamilies) Three subunits form a single 11-helix bundle at the interface between the hydrophilic domain and the antiporter-like subunits |
Superfamily f.73.1: Respiratory complex I subunit NuoK-like [418777] (1 family) |
Family f.73.1.1: Respiratory complex I subunit NuoK-like [418866] (2 proteins) Pfam PF00420 |
Protein NADH-quinone oxidoreductase subunit K, NuoK/Nqo11 [419223] (2 species) |
Species Thermus thermophilus HB8 [TaxId:300852] [419746] (1 PDB entry) |
Domain d4he8k_: 4he8 K: [413823] Other proteins in same PDB: d4he8a_, d4he8c_, d4he8j_, d4he8l_, d4he8m_, d4he8n_ complexed with umq |
PDB Entry: 4he8 (more details), 3.3 Å
SCOPe Domain Sequences for d4he8k_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4he8k_ f.73.1.1 (K:) NADH-quinone oxidoreductase subunit K, NuoK/Nqo11 {Thermus thermophilus HB8 [TaxId: 300852]} msylltsallfalgvygvltrrtailvflsielmlnaanlslvgfaraygldgqvaalmv iavaaaevavglglivaifrhrestavddlselrg
Timeline for d4he8k_: