Lineage for d4he7a_ (4he7 A:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3029893Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 3030456Superfamily g.3.7: Scorpion toxin-like [57095] (6 families) (S)
  5. 3030805Family g.3.7.5: Plant defensins [57170] (9 proteins)
  6. 3030812Protein Brazzein [57178] (1 species)
    sweet protein
  7. 3030813Species J'oublie (Pentadiplandra brazzeana) [TaxId:43545] [57179] (6 PDB entries)
  8. 3030814Domain d4he7a_: 4he7 A: [192673]
    automated match to d1brza_
    complexed with na

Details for d4he7a_

PDB Entry: 4he7 (more details), 1.8 Å

PDB Description: crystal structure of brazzein
PDB Compounds: (A:) Defensin-like protein

SCOPe Domain Sequences for d4he7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4he7a_ g.3.7.5 (A:) Brazzein {J'oublie (Pentadiplandra brazzeana) [TaxId: 43545]}
edkckkvyenypvskcqlanqcnydckldkharsgecfydekrnlqcicdycey

SCOPe Domain Coordinates for d4he7a_:

Click to download the PDB-style file with coordinates for d4he7a_.
(The format of our PDB-style files is described here.)

Timeline for d4he7a_: