Lineage for d4hbwa_ (4hbw A:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. Superfamily a.29.2: Bromodomain [47370] (2 families) (S)
  5. Family a.29.2.0: automated matches [191428] (1 protein)
    not a true family
  6. Protein automated matches [190615] (14 species)
    not a true protein
  7. Species Human (Homo sapiens) [TaxId:9606] [187641] (1029 PDB entries)
  8. Domain d4hbwa_: 4hbw A: [222489]
    automated match to d2nxba_
    complexed with 14z, edo, k

Details for d4hbwa_

PDB Entry: 4hbw (more details), 1.6900000000000002 Å

PDB Description: Crystal Structure of the first bromodomain of human BRD4 in complex with a quinazoline ligand
PDB Compounds: (A:) Bromodomain-containing protein 4

SCOPe Domain Sequences for d4hbwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4hbwa_ a.29.2.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
smnppppetsnpnkpkretnqlqyllrvvlktlwkhqfawpfqqpvdavklnlpdyykii
ktpmdmgtikkrlennyywnaqeciqdfntmftncyiynkpgddivlmaealeklflqki
nelptee

SCOPe Domain Coordinates for d4hbwa_ are not available.

Timeline for d4hbwa_: