Lineage for d4h8na_ (4h8n A:)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
the first seven superfamilies have similar phosphate-binding sitesSuperfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (2 families) 
Family c.1.7.0: automated matches [191491] (1 protein)
not a true familyProtein automated matches [190793] (31 species)
not a true protein
Species Candida parapsilosis [TaxId:5480] [224874] (3 PDB entries) 
Domain d4h8na_: 4h8n A: [234631]
automated match to d3wg6c_
complexed with ndp
Details for d4h8na_
PDB Entry: 4h8n (more details), 1.8 Å
PDB Description: Crystal structure of conjugated polyketone reductase C2 from candida parapsilosis complexed with NADPH
PDB Compounds: (A:) Conjugated polyketone reductase C2SCOPe Domain Sequences for d4h8na_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4h8na_ c.1.7.0 (A:) automated matches {Candida parapsilosis [TaxId: 5480]}
nllpktfrtksgkeisialgtgtkwkqaqtindvstelvdnillglklgfrhidtaeayn
tqkevgealkrtdvprediwvttkyspgwgsikayskspsdsidkalaqlgvdyvdlfli
hspfftteqthgytleqawealveakkagkvreigisnaaiphleklfaaspspeyypvv
nqiefhpflqnqsknivrfcqehgilveafsplaplarvetnalaetlkrlaekykktea
qvllrytlqrgilpvttsskesrlkeslnlfdfeltdeevneinkigdanpyraffheqf
kdl
SCOPe Domain Coordinates for d4h8na_:
Click to download the PDB-style file with coordinates for d4h8na_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4h8na_:
- d4h8na_ first appeared in SCOPe 2.03
- d4h8na_ appears in SCOPe 2.07
View in 3D
