Lineage for d4h7mb_ (4h7m B:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1779936Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 1779937Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 1781369Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (3 proteins)
  6. 1781549Protein automated matches [190135] (9 species)
    not a true protein
  7. 1781574Species Trichoderma harzianum [TaxId:5544] [196740] (1 PDB entry)
  8. 1781576Domain d4h7mb_: 4h7m B: [196741]
    automated match to d1oa3a_

Details for d4h7mb_

PDB Entry: 4h7m (more details), 2.07 Å

PDB Description: The X-ray Crystal Structure of the Trichoderma harzianum Endoglucanase 3 from family GH12
PDB Compounds: (B:) endo-1,4-beta-glucanase

SCOPe Domain Sequences for d4h7mb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4h7mb_ b.29.1.11 (B:) automated matches {Trichoderma harzianum [TaxId: 5544]}
eaeaefqtsceqyavfsggngysvsnnlwgqsagsgfgcitvnslnsaaswhadwqwsgg
qnnvksypnvqiaipqkrivnsigsmpttaswsytgsnlradvaydlftasnpnhvtysg
dyelmiwlarygdigpigsaqgtvtingqswtlyygfngamqvysfvapstvtnwsgdvk
nffnylrdnkgypassqyvlsyqfgtepftgsgtlnvnswtasin

SCOPe Domain Coordinates for d4h7mb_:

Click to download the PDB-style file with coordinates for d4h7mb_.
(The format of our PDB-style files is described here.)

Timeline for d4h7mb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4h7ma_