Lineage for d4h6ab_ (4h6a B:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1814894Fold b.159: AOC barrel-like [141492] (2 superfamilies)
    barrel, closed; n=8, S=10; meander; mirrored (reversed) topology to the Spreptavidin-like and Lipocalin-like folds
  4. 1814895Superfamily b.159.1: Allene oxide cyclase-like [141493] (2 families) (S)
  5. 1814952Family b.159.1.0: automated matches [193448] (1 protein)
    not a true family
  6. 1814953Protein automated matches [193449] (1 species)
    not a true protein
  7. 1814954Species Physcomitrella patens [TaxId:145481] [193450] (2 PDB entries)
  8. 1814956Domain d4h6ab_: 4h6a B: [193451]
    automated match to d2brja1
    complexed with ipa, mpd, mrd, so4

Details for d4h6ab_

PDB Entry: 4h6a (more details), 1.95 Å

PDB Description: crystal structure of the allene oxide cyclase 2 from physcomitrella patens
PDB Compounds: (B:) allene oxide cyclase

SCOPe Domain Sequences for d4h6ab_:

Sequence, based on SEQRES records: (download)

>d4h6ab_ b.159.1.0 (B:) automated matches {Physcomitrella patens [TaxId: 145481]}
ggplgsmgnkvdklagvqelsvyeinerdrgspvilpfggkkdengahanslgdlvpfsn
kvydgslqrrlgitagictlishnaekkgdryeaqysfyfgdyghisvqgpyityedtel
vvtggtgifagchgvaklhqiifpvklfytfylqgikklpeelcasvvppspsaepseqa
kkchpssvapnftn

Sequence, based on observed residues (ATOM records): (download)

>d4h6ab_ b.159.1.0 (B:) automated matches {Physcomitrella patens [TaxId: 145481]}
ggplgsmgnkvdklagvqelsvyeinerdrgspvanslgdlvpfsnkvydgslqrrlgit
agictlishnaekkgdryeaqysfyfgdyghisvqgpyityedtelvvtggtgifagchg
vaklhqiifpvklfytfylqgikklpeelcasvvppspsaepseqakkchpssvapnftn

SCOPe Domain Coordinates for d4h6ab_:

Click to download the PDB-style file with coordinates for d4h6ab_.
(The format of our PDB-style files is described here.)

Timeline for d4h6ab_: