Lineage for d4h60a_ (4h60 A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1837702Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 1837703Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 1838070Family c.23.1.0: automated matches [191324] (1 protein)
    not a true family
  6. 1838071Protein automated matches [190131] (59 species)
    not a true protein
  7. 1838312Species Vibrio cholerae [TaxId:345073] [226740] (2 PDB entries)
  8. 1838313Domain d4h60a_: 4h60 A: [222398]
    automated match to d3crnb_
    complexed with ca, so4

Details for d4h60a_

PDB Entry: 4h60 (more details), 1.66 Å

PDB Description: High resolution structure of Vibrio cholerae chemotaxis protein CheY4 crystallized in low pH (4.0) condition
PDB Compounds: (A:) Chemotaxis protein cheY

SCOPe Domain Sequences for d4h60a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4h60a_ c.23.1.0 (A:) automated matches {Vibrio cholerae [TaxId: 345073]}
amakvlavddsisirqmvshtlqdagyevetaadgrealakaqkarfdviisdvnmpvmt
gfefvkavrmqsqykftpilmlttetspekkqegkavgatgwlvkpfnpetllktlqrvl

SCOPe Domain Coordinates for d4h60a_:

Click to download the PDB-style file with coordinates for d4h60a_.
(The format of our PDB-style files is described here.)

Timeline for d4h60a_: