Lineage for d4h5wb1 (4h5w B:3-188)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2883383Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2883384Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 2883385Family c.55.1.1: Actin/HSP70 [53068] (8 proteins)
  6. 2883861Protein automated matches [226905] (13 species)
    not a true protein
  7. 2883942Species Human (Homo sapiens) [TaxId:9606] [225574] (54 PDB entries)
  8. 2883993Domain d4h5wb1: 4h5w B:3-188 [237789]
    automated match to d2e8aa1
    complexed with act, bet, mg, po4

Details for d4h5wb1

PDB Entry: 4h5w (more details), 1.94 Å

PDB Description: HSC70 NBD with betaine
PDB Compounds: (B:) Heat shock cognate 71 kDa protein

SCOPe Domain Sequences for d4h5wb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4h5wb1 c.55.1.1 (B:3-188) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kgpavgidlgttyscvgvfqhgkveiiandqgnrttpsyvaftdterligdaaknqvamn
ptntvfdakrligrrfddavvqsdmkhwpfmvvndagrpkvqveykgetksfypeevssm
vltkmkeiaeaylgktvtnavvtvpayfndsqrqatkdagtiaglnvlriineptaaaia
ygldkk

SCOPe Domain Coordinates for d4h5wb1:

Click to download the PDB-style file with coordinates for d4h5wb1.
(The format of our PDB-style files is described here.)

Timeline for d4h5wb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4h5wb2