Lineage for d4h4ia_ (4h4i A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2827845Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) (S)
  5. 2827846Family c.1.4.1: FMN-linked oxidoreductases [51396] (19 proteins)
  6. 2828208Protein Old yellow enzyme (OYE) [51401] (2 species)
  7. 2828209Species Lager yeast (Saccharomyces pastorianus) [TaxId:27292] [51402] (20 PDB entries)
  8. 2828214Domain d4h4ia_: 4h4i A: [228170]
    automated match to d3rnda_
    complexed with 0wv, 1pe, cl, fmn, mg, na; mutant

    has additional insertions and/or extensions that are not grouped together

Details for d4h4ia_

PDB Entry: 4h4i (more details), 1.25 Å

PDB Description: OYE1-W116V complexed with the dismutation product of (S)-carvone
PDB Compounds: (A:) nadph dehydrogenase 1

SCOPe Domain Sequences for d4h4ia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4h4ia_ c.1.4.1 (A:) Old yellow enzyme (OYE) {Lager yeast (Saccharomyces pastorianus) [TaxId: 27292]}
sfvkdfkpqalgdtnlfkpikignnellhravippltrmralhpgnipnrdwaveyytqr
aqrpgtmiitegafispqaggydnapgvwseeqmvewtkifnaihekksfvwvqlvvlgw
aafpdnlardglrydsasdnvfmdaeqeakakkannpqhsltkdeikqyikeyvqaakns
iaagadgveihsangyllnqfldphsntrtdeyggsienrarftlevvdalveaighekv
glrlspygvfnsmsggaetgivaqyayvagelekrakagkrlafvhlveprvtnpflteg
egeyeggsndfvysiwkgpviragnfalhpevvreevkdkrtligygrffisnpdlvdrl
ekglplnkydrdtfyqmsahgyidyptyeealklgwdkk

SCOPe Domain Coordinates for d4h4ia_:

Click to download the PDB-style file with coordinates for d4h4ia_.
(The format of our PDB-style files is described here.)

Timeline for d4h4ia_: