Lineage for d4h05b1 (4h05 B:1-267)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2979545Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2979546Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2984752Family d.144.1.0: automated matches [191359] (1 protein)
    not a true family
  6. 2984753Protein automated matches [190417] (37 species)
    not a true protein
  7. 2987377Species Streptomyces rimosus [TaxId:1927] [238355] (2 PDB entries)
  8. 2987380Domain d4h05b1: 4h05 B:1-267 [238357]
    Other proteins in same PDB: d4h05a2, d4h05b2
    automated match to d1nd4a_

Details for d4h05b1

PDB Entry: 4h05 (more details), 2.15 Å

PDB Description: crystal structure of aminoglycoside-3'-phosphotransferase of type viii
PDB Compounds: (B:) Aminoglycoside-O-phosphotransferase VIII

SCOPe Domain Sequences for d4h05b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4h05b1 d.144.1.0 (B:1-267) automated matches {Streptomyces rimosus [TaxId: 1927]}
mddalralrgrypgcewvvvedgasgagvyrlrgggrelfvkvaalgagvgllgeaerlv
wlaevgipvprvvegggdervawlvteavpgrpasarwpreqrldvavalaglarslhal
dwercpfdrslavtvpqaaravaegsvdledldeerkgwsgerllaelertrpadedlav
chgdlcpdnvlldprtcevtglidvgrvgradrhsdlalvlrelaheedpwfgpecsaaf
lreygrgwdgavseeklafyrlldeff

SCOPe Domain Coordinates for d4h05b1:

Click to download the PDB-style file with coordinates for d4h05b1.
(The format of our PDB-style files is described here.)

Timeline for d4h05b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4h05b2