Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) shares functional and structural similarities with the ATP-grasp fold and PIPK |
Family d.144.1.0: automated matches [191359] (1 protein) not a true family |
Protein automated matches [190417] (37 species) not a true protein |
Species Streptomyces rimosus [TaxId:1927] [238355] (2 PDB entries) |
Domain d4h05b1: 4h05 B:1-267 [238357] Other proteins in same PDB: d4h05a2, d4h05b2 automated match to d1nd4a_ |
PDB Entry: 4h05 (more details), 2.15 Å
SCOPe Domain Sequences for d4h05b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4h05b1 d.144.1.0 (B:1-267) automated matches {Streptomyces rimosus [TaxId: 1927]} mddalralrgrypgcewvvvedgasgagvyrlrgggrelfvkvaalgagvgllgeaerlv wlaevgipvprvvegggdervawlvteavpgrpasarwpreqrldvavalaglarslhal dwercpfdrslavtvpqaaravaegsvdledldeerkgwsgerllaelertrpadedlav chgdlcpdnvlldprtcevtglidvgrvgradrhsdlalvlrelaheedpwfgpecsaaf lreygrgwdgavseeklafyrlldeff
Timeline for d4h05b1: