Lineage for d4gyvb_ (4gyv B:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1740983Fold a.87: DBL homology domain (DH-domain) [48064] (1 superfamily)
    multihelical; core: 5-helical bundle
  4. 1740984Superfamily a.87.1: DBL homology domain (DH-domain) [48065] (2 families) (S)
    automatically mapped to Pfam PF00621
  5. 1741046Family a.87.1.0: automated matches [233075] (1 protein)
    not a true family
  6. 1741047Protein automated matches [233076] (2 species)
    not a true protein
  7. 1741053Species Mouse (Mus musculus) [TaxId:10090] [234557] (1 PDB entry)
  8. 1741055Domain d4gyvb_: 4gyv B: [234560]
    automated match to d1by1a_

Details for d4gyvb_

PDB Entry: 4gyv (more details), 2.9 Å

PDB Description: crystal structure of the dh domain of farp2
PDB Compounds: (B:) FERM, RhoGEF and pleckstrin domain-containing protein 2

SCOPe Domain Sequences for d4gyvb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4gyvb_ a.87.1.0 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
gphmedeayfiakeilatertylkdlevitvwfrsvlikeeampaalmallfsnidpvye
fhrgflheveqrlalwegpssahlkgdhqrigdillrnmrqlkeftsyfqrhdevltele
katkhckkleavykefelqkvcylplntfllkpvqrlvhyrlllsrlcahyspghrdyad
chealkaitevttelqqsltrlenlqkltelqrdlv

SCOPe Domain Coordinates for d4gyvb_:

Click to download the PDB-style file with coordinates for d4gyvb_.
(The format of our PDB-style files is described here.)

Timeline for d4gyvb_: