Lineage for d4gyqc_ (4gyq C:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2231215Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 2231216Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) (S)
  5. 2231713Family d.157.1.0: automated matches [191360] (1 protein)
    not a true family
  6. 2231714Protein automated matches [190418] (18 species)
    not a true protein
  7. 2231748Species Klebsiella pneumoniae [TaxId:573] [189718] (37 PDB entries)
  8. 2231757Domain d4gyqc_: 4gyq C: [194621]
    automated match to d3srxa_
    complexed with edo, mg; mutant

Details for d4gyqc_

PDB Entry: 4gyq (more details), 1.35 Å

PDB Description: crystal structure of new delhi metallo-beta-lactamase-1 d223a mutant from klebsiella pneumoniae
PDB Compounds: (C:) Beta-lactamase NDM-1

SCOPe Domain Sequences for d4gyqc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4gyqc_ d.157.1.0 (C:) automated matches {Klebsiella pneumoniae [TaxId: 573]}
tigqqmetgdqrfgdlvfrqlapnvwqhtsyldmpgfgavasnglivrdggrvlvvdtaw
tddqtaqilnwikqeinlpvalavvthahqdkmggmdalhaagiatyanalsnqlapqeg
mvaaqhsltfaangwvepatapnfgplkvfypgpghtsdnitvgidgtdiafggclikds
kakslgnlgaadtehyaasarafgaafpkasmivmshsapdsraaithtarmadklr

SCOPe Domain Coordinates for d4gyqc_:

Click to download the PDB-style file with coordinates for d4gyqc_.
(The format of our PDB-style files is described here.)

Timeline for d4gyqc_: