Lineage for d4gxaa_ (4gxa A:)
- Root: SCOPe 2.07
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the restSuperfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) 
Similar in architecture to the superfamily I but partly differs in topologyFamily c.94.1.1: Phosphate binding protein-like [53851] (45 proteins) 
Protein automated matches [190140] (38 species)
not a true protein
Species Salmonella enterica [TaxId:99287] [227690] (7 PDB entries) 
Domain d4gxaa_: 4gxa A: [227691]
automated match to d1al3a_
Details for d4gxaa_
PDB Entry: 4gxa (more details), 2.81 Å
PDB Description: Crystal structure of Sulfate free form of CYSB, a member of LysR family from Salmonella typhimurium LT2
PDB Compounds: (A:) HTH-type transcriptional regulator CysBSCOPe Domain Sequences for d4gxaa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4gxaa_ c.94.1.1 (A:) automated matches {Salmonella enterica [TaxId: 99287]}
ehtwpdkgslyiatthtqaryalpgvikgfieryprvslhmhqgsptqiaeavskgnadf
aiatealhlyddlvmlpcyhwnrsivvtpdhplaatssvtiealaqyplvtytfgftgrs
eldtafnragltprivftatdadviktyvrlglgvgviasmavdpladpdlvridahdif
shsttkigfrrstflrsymydfiqrfaphltrdvvdtavalrsneeieamfqdiklpek
SCOPe Domain Coordinates for d4gxaa_:
Click to download the PDB-style file with coordinates for d4gxaa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4gxaa_:
- d4gxaa_ first appeared in SCOPe 2.03
- d4gxaa_ appears in SCOPe 2.06
- d4gxaa_ appears in the current release, SCOPe 2.08
View in 3D
