Lineage for d4gv5a_ (4gv5 A:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3032898Fold g.9: Defensin-like [57391] (1 superfamily)
    Disulfide-rich fold, nearly all-beta
  4. 3032899Superfamily g.9.1: Defensin-like [57392] (3 families) (S)
  5. 3033037Family g.9.1.2: Myotoxin [90157] (1 protein)
    structurally similar to beta-defensin
    automatically mapped to Pfam PF00819
  6. 3033038Protein Crotamine [90158] (1 species)
  7. 3033039Species South american rattlesnake (Crotalus durissus terrificus) [TaxId:8732] [90159] (3 PDB entries)
  8. 3033040Domain d4gv5a_: 4gv5 A: [227682]
    automated match to d1h5oa_
    complexed with gol, scn, so4

Details for d4gv5a_

PDB Entry: 4gv5 (more details), 1.7 Å

PDB Description: x-ray structure of crotamine, a cell-penetrating peptide from the brazilian snake crotalus durissus terrificus
PDB Compounds: (A:) Crotamine Ile-19

SCOPe Domain Sequences for d4gv5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4gv5a_ g.9.1.2 (A:) Crotamine {South american rattlesnake (Crotalus durissus terrificus) [TaxId: 8732]}
ykqchkkgghcfpkekiclppssdfgkmdcrwrwkcckkgsg

SCOPe Domain Coordinates for d4gv5a_:

Click to download the PDB-style file with coordinates for d4gv5a_.
(The format of our PDB-style files is described here.)

Timeline for d4gv5a_: