Lineage for d4gv2a1 (4gv2 A:176-321)
- Root: SCOPe 2.05
Class a: All alpha proteins [46456] (286 folds) 
Fold a.41: Domain of poly(ADP-ribose) polymerase [47586] (1 superfamily)
core: 4 helices: bundle; unusual topologySuperfamily a.41.1: Domain of poly(ADP-ribose) polymerase [47587] (2 families) 
duplication: consists of 2 helix-loop-helix structural repeats
automatically mapped to Pfam PF02877Family a.41.1.0: automated matches [227223] (1 protein)
not a true familyProtein automated matches [226964] (1 species)
not a true proteinSpecies Human (Homo sapiens) [TaxId:9606] [225405] (32 PDB entries) 
Domain d4gv2a1: 4gv2 A:176-321 [222192]
Other proteins in same PDB: d4gv2a2
automated match to d1gs0a1
complexed with 5me, dms
Details for d4gv2a1
PDB Entry: 4gv2 (more details), 1.8 Å
PDB Description: human artd3 (parp3) - catalytic domain in complex with inhibitor me0354
PDB Compounds: (A:) Poly [ADP-ribose] polymerase 3SCOPe Domain Sequences for d4gv2a1:
Sequence, based on SEQRES records: (download)
>d4gv2a1 a.41.1.0 (A:176-321) automated matches {Human (Homo sapiens) [TaxId: 9606]}
smkrvqpcsldpatqklitnifskemfkntmalmdldvkkmplgklskqqiargfealea
leealkgptdggqsleelsshfytviphnfghsqpppinspellqakkdmllvladiela
qalqavseqektveevphpldrdyql
Sequence, based on observed residues (ATOM records): (download)
>d4gv2a1 a.41.1.0 (A:176-321) automated matches {Human (Homo sapiens) [TaxId: 9606]}
smkrvqpcsldpatqklitnifskemfkntmalmdldvkkmplgklskqqiargfealea
leealkdggqsleelsshfytviphnfghsqpppinspellqakkdmllvladielaqal
qavseqektveevphpldrdyql
SCOPe Domain Coordinates for d4gv2a1:
Click to download the PDB-style file with coordinates for d4gv2a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4gv2a1:
- d4gv2a1 first appeared in SCOPe 2.03
- d4gv2a1 appears in SCOPe 2.04
- d4gv2a1 appears in SCOPe 2.06
- d4gv2a1 appears in the current release, SCOPe 2.08
View in 3D
