Lineage for d4gune2 (4gun E:90-206)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1411453Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
    alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213
  4. 1411454Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) (S)
    automatically mapped to Pfam PF02777
  5. 1411726Family d.44.1.0: automated matches [227155] (1 protein)
    not a true family
  6. 1411727Protein automated matches [226860] (25 species)
    not a true protein
  7. 1411852Species Yeast (Candida albicans) [TaxId:5476] [226298] (2 PDB entries)
  8. 1411857Domain d4gune2: 4gun E:90-206 [227920]
    Other proteins in same PDB: d4guna1, d4gunb1, d4gunc1, d4gund1, d4gune1, d4gunf1, d4gung1, d4gunh1, d4guni1, d4gunj1, d4gunk1, d4gunl1, d4gunm1, d4gunn1, d4guno1, d4gunp1
    automated match to d3qvna2
    complexed with mn, so4; mutant

Details for d4gune2

PDB Entry: 4gun (more details), 1.94 Å

PDB Description: Crystal Structure of the K184R, L185P mutant manganese superoxide dismutase from Candida albicans cytosol
PDB Compounds: (E:) superoxide dismutase

SCOPe Domain Sequences for d4gune2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4gune2 d.44.1.0 (E:90-206) automated matches {Yeast (Candida albicans) [TaxId: 5476]}
vskgggkhpdtssalgkqivaqygsvsnliditnsklagiqgsgwafivknkqnggaldv
vttanqdtisaphlvpiiaidawehayylqyqnvrpdyfkaiwnvinwaeaesrysa

SCOPe Domain Coordinates for d4gune2:

Click to download the PDB-style file with coordinates for d4gune2.
(The format of our PDB-style files is described here.)

Timeline for d4gune2:

1411857
d4gune2 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d4gune1