Lineage for d4grfa_ (4grf A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1852416Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 1852417Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 1854430Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 1854431Protein automated matches [190056] (147 species)
    not a true protein
  7. 1854548Species Bacteroides vulgatus [TaxId:435590] [194549] (5 PDB entries)
  8. 1854549Domain d4grfa_: 4grf A: [194550]
    automated match to d2f9sa_
    complexed with cl, gsh, so4

Details for d4grfa_

PDB Entry: 4grf (more details), 1.76 Å

PDB Description: Crystal structure of thioredoxin domain of thiol-disulfide oxidoreductase BVU-2223 (Target EFI-501010) from Bacteroides vulgatus
PDB Compounds: (A:) Putative thiol-disulfide oxidoreductase

SCOPe Domain Sequences for d4grfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4grfa_ c.47.1.0 (A:) automated matches {Bacteroides vulgatus [TaxId: 435590]}
slatgsvapaitgidlkgnsvslndfkgkyvlvdfwfagcswcrketpyllktynafkdk
gftiygvstdrreedwkkaieedksywnqvllqkddvkdvlesycivgfphiilvdpegk
ivakelrgddlyntvekfvn

SCOPe Domain Coordinates for d4grfa_:

Click to download the PDB-style file with coordinates for d4grfa_.
(The format of our PDB-style files is described here.)

Timeline for d4grfa_: