Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
Protein automated matches [190056] (147 species) not a true protein |
Species Bacteroides vulgatus [TaxId:435590] [194549] (5 PDB entries) |
Domain d4grfa_: 4grf A: [194550] automated match to d2f9sa_ complexed with cl, gsh, so4 |
PDB Entry: 4grf (more details), 1.76 Å
SCOPe Domain Sequences for d4grfa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4grfa_ c.47.1.0 (A:) automated matches {Bacteroides vulgatus [TaxId: 435590]} slatgsvapaitgidlkgnsvslndfkgkyvlvdfwfagcswcrketpyllktynafkdk gftiygvstdrreedwkkaieedksywnqvllqkddvkdvlesycivgfphiilvdpegk ivakelrgddlyntvekfvn
Timeline for d4grfa_: