Lineage for d4gr7a_ (4gr7 A:)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.11: gamma-Crystallin-like [49694] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key
    duplication: has internal pseudo twofold symmetry
  4. Superfamily b.11.1: gamma-Crystallin-like [49695] (7 families) (S)
  5. Family b.11.1.0: automated matches [191607] (1 protein)
    not a true family
  6. Protein automated matches [191109] (11 species)
    not a true protein
  7. Species Human (Homo sapiens) [TaxId:9606] [230909] (14 PDB entries)
  8. Domain d4gr7a_: 4gr7 A: [234493]
    automated match to d1bd7a_
    complexed with po4; mutant

Details for d4gr7a_

PDB Entry: 4gr7 (more details), 1.7000000000000002 Å

PDB Description: The human W42R Gamma D-Crystallin Mutant Structure at 1.7A Resolution
PDB Compounds: (A:) Gamma-crystallin D

SCOPe Domain Sequences for d4gr7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4gr7a_ b.11.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gkitlyedrgfqgrhyecssdhpnlqpylsrcnsarvdsgcrmlyeqpnysglqyflrrg
dyadhqqwmglsdsvrscrliphsgshrirlyeredyrgqmieftedcsclqdrfrfnei
hslnvlegswvlyelsnyrgrqyllmpgdyrryqdwgatnarvgslrrvidfs

SCOPe Domain Coordinates for d4gr7a_ are not available.

Timeline for d4gr7a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4gr7x_