Class a: All alpha proteins [46456] (290 folds) |
Fold a.280: RbcX-like [158614] (1 superfamily) 5 helices per subunit; irregular array of short and long helices; swapping of the C-terminal helices in the dimer |
Superfamily a.280.1: RbcX-like [158615] (2 families) |
Family a.280.1.0: automated matches [191655] (1 protein) not a true family |
Protein automated matches [191222] (3 species) not a true protein |
Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [256275] (2 PDB entries) |
Domain d4gr2a_: 4gr2 A: [252323] automated match to d2peik_ |
PDB Entry: 4gr2 (more details), 2 Å
SCOPe Domain Sequences for d4gr2a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4gr2a_ a.280.1.0 (A:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} easpeakaakhlhdfftyvavrivsaqlesynpeaymelrefldtnsvsdgdkflatlmr rssrhmnlalrilevrsayakndfewdnmkrlafknvddsntrlmreyvl
Timeline for d4gr2a_: