Lineage for d4gr2a_ (4gr2 A:)
- Root: SCOPe 2.08
Class a: All alpha proteins [46456] (290 folds) 
Fold a.280: RbcX-like [158614] (1 superfamily)
5 helices per subunit; irregular array of short and long helices; swapping of the C-terminal helices in the dimerSuperfamily a.280.1: RbcX-like [158615] (2 families) 
Family a.280.1.0: automated matches [191655] (1 protein)
not a true familyProtein automated matches [191222] (3 species)
not a true protein
Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [256275] (2 PDB entries) 
Domain d4gr2a_: 4gr2 A: [252323]
automated match to d2peik_
Details for d4gr2a_
PDB Entry: 4gr2 (more details), 2 Å
PDB Description: Structure of AtRbcX1 from Arabidopsis thaliana.
PDB Compounds: (A:) AtRbcX1SCOPe Domain Sequences for d4gr2a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4gr2a_ a.280.1.0 (A:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
easpeakaakhlhdfftyvavrivsaqlesynpeaymelrefldtnsvsdgdkflatlmr
rssrhmnlalrilevrsayakndfewdnmkrlafknvddsntrlmreyvl
SCOPe Domain Coordinates for d4gr2a_:
Click to download the PDB-style file with coordinates for d4gr2a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4gr2a_:
- d4gr2a_ first appeared in SCOPe 2.04
- d4gr2a_ appears in SCOPe 2.07
View in 3D
