Lineage for d4gq7a_ (4gq7 A:)
- Root: SCOPe 2.05
Class b: All beta proteins [48724] (176 folds) 
Fold b.179: Anthrax protective antigen N-terminal-like [254104] (1 superfamily)
core: sandwich; 10-12 strands in 2 sheets; jelly roll; may contain inserted subdomainsSuperfamily b.179.1: PA14-like [254123] (3 families) 
Family b.179.1.2: GLEYA domain [254187] (2 proteins)
Pfam PF10528
PubMed 21149680; inserted Flo5 subdomain (84-120) contains 5 short beta strands and two disulfide bridges
Protein automated matches [254737] (2 species)
not a true protein
Species Lager yeast (Saccharomyces pastorianus) [TaxId:27292] [267943] (2 PDB entries) 
Domain d4gq7a_: 4gq7 A: [266334]
automated match to d4lhna_
complexed with ca, nag
Details for d4gq7a_
PDB Entry: 4gq7 (more details), 2.53 Å
PDB Description: crystal structure of lg-flo1p
PDB Compounds: (A:) FlocculinSCOPe Domain Sequences for d4gq7a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4gq7a_ b.179.1.2 (A:) automated matches {Lager yeast (Saccharomyces pastorianus) [TaxId: 27292]}
aeatqaclpvgsrkngmnvnfykyslqdsttysdpqymaykysdtkklgsvsgqthlsiy
ygpntafwntaswssdlfgfyttptnvtvemtgyflppqtgsytfkfatvddsailsvgg
siafeccaqeqppitstdftingikpwdaaaptdikgstymyagyyypikivysnakala
rlpvsvvlpdgtevnddfegyvysfdddlsqsnctipdps
SCOPe Domain Coordinates for d4gq7a_:
Click to download the PDB-style file with coordinates for d4gq7a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4gq7a_:
- d4gq7a_ is new in SCOPe 2.05-stable
- d4gq7a_ is called d4gq7a1 in SCOPe 2.06
- d4gq7a_ appears in the current release, SCOPe 2.08, called d4gq7a1
View in 3D