Lineage for d4gpnb_ (4gpn B:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2093018Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2095300Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 2095301Protein automated matches [190075] (90 species)
    not a true protein
  7. 2095925Species Streptococcus mutans [TaxId:210007] [194595] (4 PDB entries)
  8. 2095927Domain d4gpnb_: 4gpn B: [194596]
    Other proteins in same PDB: d4gpna2
    automated match to d3qoma_
    complexed with 6gb, gol, trs; mutant

Details for d4gpnb_

PDB Entry: 4gpn (more details), 2.29 Å

PDB Description: the crystal structure of 6-p-beta-d-glucosidase (e375q mutant) from streptococcus mutans ua150 in complex with gentiobiose 6-phosphate.
PDB Compounds: (B:) 6-phospho-beta-D-Glucosidase

SCOPe Domain Sequences for d4gpnb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4gpnb_ c.1.8.0 (B:) automated matches {Streptococcus mutans [TaxId: 210007]}
sklpenflwggavaahqleggwqeggkgisvadvmtagrhgvareitagvlegkyypnhe
aidfyhhykedvklfaemgfkcfrtsiawtrifpkgdeaepneaglqfyddlfdeclkyg
iepvvtlshfelpyhlvteyggftnrkvidffvhfaevcfrrykdkvkywmtfneinnqa
nyqedfapftnsgivykegddreaimyqaahyelvasaravkighainpnlnigcmvamc
piypatcnpkdilmaqkamqkryyfadvhvhgfypehifkywerkaikvdfterdkkdlf
egtvdyigfsyymsfvidahrennpyydyletedlvknpyvkasdwdwqidpqglryaln
wftdmyhlplfivqngfgaidqveadgmvhddyridylgahikemikavdedgvelmgyt
pwgcidlvsagtgemrkrygfiyvdkddegkgtlkrspklsfnwykeviasngddi

SCOPe Domain Coordinates for d4gpnb_:

Click to download the PDB-style file with coordinates for d4gpnb_.
(The format of our PDB-style files is described here.)

Timeline for d4gpnb_: