Lineage for d4gm9b_ (4gm9 B:)
- Root: SCOPe 2.07
Class b: All beta proteins [48724] (178 folds) 
Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies)
consists of seven 4-stranded beta-sheet motifs; meanderSuperfamily b.69.4: WD40 repeat-like [50978] (4 families) 
also contains 8-bladed propellers
Family b.69.4.0: automated matches [191412] (1 protein)
not a true familyProtein automated matches [190568] (9 species)
not a true proteinSpecies Human (Homo sapiens) [TaxId:9606] [187559] (91 PDB entries) 
Domain d4gm9b_: 4gm9 B: [236992]
automated match to d4gm8c_
Details for d4gm9b_
PDB Entry: 4gm9 (more details), 2.1 Å
PDB Description: crystal structure of human wd repeat domain 5 with compound mm-401
PDB Compounds: (B:) WD repeat-containing protein 5SCOPe Domain Sequences for d4gm9b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4gm9b_ b.69.4.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qskptpvkpnyalkftlaghtkavssvkfspngewlasssadklikiwgaydgkfektis
ghklgisdvawssdsnllvsasddktlkiwdvssgkclktlkghsnyvfccnfnpqsnli
vsgsfdesvriwdvktgkclktlpahsdpvsavhfnrdgslivsssydglcriwdtasgq
clktlidddnppvsfvkfspngkyilaatldntlklwdyskgkclktytghknekycifa
nfsvtggkwivsgsednlvyiwnlqtkeivqklqghtdvvistachpteniiasaalend
ktiklwksdc
SCOPe Domain Coordinates for d4gm9b_:
Click to download the PDB-style file with coordinates for d4gm9b_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4gm9b_:
- d4gm9b_ first appeared in SCOPe 2.03
- d4gm9b_ appears in SCOPe 2.06
- d4gm9b_ appears in the current release, SCOPe 2.08
View in 3D
