| Class b: All beta proteins [48724] (174 folds) |
| Fold b.8: TRAF domain-like [49598] (1 superfamily) sandwich; 8 strands in 2 sheets; greek-key |
Superfamily b.8.1: TRAF domain-like [49599] (3 families) ![]() has a circularly permuted immunoglobulin-fold topology with extra strand |
| Family b.8.1.0: automated matches [227285] (1 protein) not a true family |
| Protein automated matches [227102] (1 species) not a true protein |
| Species Mouse (Mus musculus) [TaxId:10090] [226532] (1 PDB entry) |
| Domain d4gjha_: 4gjh A: [221957] automated match to d1lb4a_ |
PDB Entry: 4gjh (more details), 2.81 Å
SCOPe Domain Sequences for d4gjha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4gjha_ b.8.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
hkaqlnkneerfkqlegacysgkliwkvtdyrvkkreaveghtvsvfsqpfytsrcgyrl
caraylngdgsgkgthlslyfvvmrgefdsllqwpfrqrvtlmlldqsgkknhivetfka
dpnsssfkrpdgemniasgcprfvshstlenskntyikddtlflkvavdltdled
Timeline for d4gjha_: