Lineage for d4gixa_ (4gix A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1754112Fold a.224: Glycolipid transfer protein, GLTP [110003] (1 superfamily)
    multihelical; 2 layers or orthogonally packed helices
  4. 1754113Superfamily a.224.1: Glycolipid transfer protein, GLTP [110004] (1 family) (S)
  5. 1754114Family a.224.1.1: Glycolipid transfer protein, GLTP [110005] (2 proteins)
  6. 1754115Protein Glycolipid transfer protein, GLTP [110006] (2 species)
  7. 1754118Species Human (Homo sapiens) [TaxId:9606] [110007] (20 PDB entries)
    Uniprot Q9NZD2
  8. 1754127Domain d4gixa_: 4gix A: [196776]
    automated match to d2euka_
    complexed with 0sg

Details for d4gixa_

PDB Entry: 4gix (more details), 1.8 Å

PDB Description: Crystal structure of human GLTP bound with 12:0 disulfatide
PDB Compounds: (A:) glycolipid transfer protein

SCOPe Domain Sequences for d4gixa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4gixa_ a.224.1.1 (A:) Glycolipid transfer protein, GLTP {Human (Homo sapiens) [TaxId: 9606]}
llaehllkplpadkqietgpfleavshlppffdclgspvftpikadisgnitkikavydt
npakfrtlqnilevekemygaewpkvgatlalmwlkrglrfiqvflqsicdgerdenhpn
lirvnatkayemalkkyhgwivqkifqaalyaapyksdflkalskgqnvteeeclekirl
flvnytatidviyemytqmnaelnykv

SCOPe Domain Coordinates for d4gixa_:

Click to download the PDB-style file with coordinates for d4gixa_.
(The format of our PDB-style files is described here.)

Timeline for d4gixa_: