Lineage for d4ggga_ (4ggg A:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1477565Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1478534Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1478682Family a.4.5.5: ArsR-like transcriptional regulators [46801] (5 proteins)
    The N- and C-terminal helical extensions to the common fold form the dimer interface
  6. 1478713Protein automated matches [191027] (2 species)
    not a true protein
  7. 1478725Species Staphylococcus aureus [TaxId:158879] [193060] (1 PDB entry)
  8. 1478726Domain d4ggga_: 4ggg A: [193061]
    automated match to d1r1uc_
    complexed with cl, zn

Details for d4ggga_

PDB Entry: 4ggg (more details), 2 Å

PDB Description: crystal structure of v66a/l68v czra in the zn(ii)bound state.
PDB Compounds: (A:) repressor protein

SCOPe Domain Sequences for d4ggga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ggga_ a.4.5.5 (A:) automated matches {Staphylococcus aureus [TaxId: 158879]}
dtlervteifkalgdynririmellsvseasvghishqlnlsqsnvshqlkllksahvvk
akrqgqsmiyslddihvatmlkqaihhanhpk

SCOPe Domain Coordinates for d4ggga_:

Click to download the PDB-style file with coordinates for d4ggga_.
(The format of our PDB-style files is described here.)

Timeline for d4ggga_:

1478726
d4ggga_ in context of PDB
View in 3D
Domains from other chains:
(mouse over for more information)
d4gggb_