Lineage for d4ggga_ (4ggg A:)
- Root: SCOPe 2.08
Class a: All alpha proteins [46456] (290 folds) 
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and downSuperfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) 
contains a small beta-sheet (wing)
Family a.4.5.5: ArsR-like transcriptional regulators [46801] (5 proteins)
The N- and C-terminal helical extensions to the common fold form the dimer interface
Protein automated matches [191027] (2 species)
not a true proteinSpecies Staphylococcus aureus [TaxId:158879] [193060] (1 PDB entry) 
Domain d4ggga_: 4ggg A: [193061]
automated match to d1r1uc_
complexed with cl, zn
Details for d4ggga_
PDB Entry: 4ggg (more details), 2 Å
PDB Description: crystal structure of v66a/l68v czra in the zn(ii)bound state.
PDB Compounds: (A:) repressor proteinSCOPe Domain Sequences for d4ggga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ggga_ a.4.5.5 (A:) automated matches {Staphylococcus aureus [TaxId: 158879]}
dtlervteifkalgdynririmellsvseasvghishqlnlsqsnvshqlkllksahvvk
akrqgqsmiyslddihvatmlkqaihhanhpk
SCOPe Domain Coordinates for d4ggga_:
Click to download the PDB-style file with coordinates for d4ggga_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4ggga_:
- d4ggga_ first appeared in SCOPe 2.02
- d4ggga_ appears in SCOPe 2.07
View in 3D
