Lineage for d4gata_ (4gat A:)

  1. Root: SCOP 1.75
  2. 888632Class g: Small proteins [56992] (90 folds)
  3. 892407Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. 892408Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (18 families) (S)
  5. 892409Family g.39.1.1: Erythroid transcription factor GATA-1 [57717] (1 protein)
    single zinc-binding motif
  6. 892410Protein Erythroid transcription factor GATA-1 [57718] (3 species)
  7. 892411Species Chicken (Gallus gallus) [TaxId:9031] [57719] (8 PDB entries)
  8. 892415Domain d4gata_: 4gat A: [45100]
    protein/DNA complex; complexed with zn

Details for d4gata_

PDB Entry: 4gat (more details)

PDB Description: solution nmr structure of the wild type dna binding domain of area complexed to a 13bp dna containing a cgata site, regularized mean structure
PDB Compounds: (A:) nitrogen regulatory protein area

SCOP Domain Sequences for d4gata_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4gata_ g.39.1.1 (A:) Erythroid transcription factor GATA-1 {Chicken (Gallus gallus) [TaxId: 9031]}
mkngeqngpttctncftqttplwrrnpegqplcnacglflklhgvvrplslktdvikkrn
rnsans

SCOP Domain Coordinates for d4gata_:

Click to download the PDB-style file with coordinates for d4gata_.
(The format of our PDB-style files is described here.)

Timeline for d4gata_: