Lineage for d4gafb1 (4gaf B:4-104)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.4: I set domains [49159] (39 proteins) 
Protein Type-1 interleukin-1 receptor [49177] (1 species)
duplication: tandem repeat of 3 domainsSpecies Human (Homo sapiens) [TaxId:9606] [49178] (4 PDB entries) 
Domain d4gafb1: 4gaf B:4-104 [202219]
Other proteins in same PDB: d4gafa_
automated match to d1iray1
complexed with na, nag
Details for d4gafb1
PDB Entry: 4gaf (more details), 2.15 Å
PDB Description: crystal structure of ebi-005, a chimera of human il-1beta and il-1ra, bound to human interleukin-1 receptor type 1
PDB Compounds: (B:) Interleukin-1 receptor type 1SCOPe Domain Sequences for d4gafb1:
Sequence, based on SEQRES records: (download)
>d4gafb1 b.1.1.4 (B:4-104) Type-1 interleukin-1 receptor {Human (Homo sapiens) [TaxId: 9606]}
dkckereekiilvssaneidvrpcplnpnehkgtitwykddsktpvsteqasrihqhkek
lwfvpakvedsghyycvvrnssyclrikisakfvenepnlc
Sequence, based on observed residues (ATOM records): (download)
>d4gafb1 b.1.1.4 (B:4-104) Type-1 interleukin-1 receptor {Human (Homo sapiens) [TaxId: 9606]}
dkckereekiilvssaneidvrpcplnpnehkgtitwykddsktpvsteqasrihqhkek
lwfvpakvedsghyycvvyclrikisakfvenepnlc
SCOPe Domain Coordinates for d4gafb1:
Click to download the PDB-style file with coordinates for d4gafb1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4gafb1:
- d4gafb1 first appeared in SCOPe 2.03
- d4gafb1 appears in SCOPe 2.07
View in 3D
