Lineage for d4g92b_ (4g92 B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2698054Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 2698055Superfamily a.22.1: Histone-fold [47113] (5 families) (S)
  5. 2699133Family a.22.1.3: TBP-associated factors, TAFs [47134] (14 proteins)
  6. 2699191Protein automated matches [194413] (5 species)
    not a true protein
  7. 2699192Species Aspergillus nidulans [TaxId:227321] [194414] (2 PDB entries)
  8. 2699193Domain d4g92b_: 4g92 B: [194415]
    automated match to d1n1ja_
    protein/DNA complex; complexed with so4

Details for d4g92b_

PDB Entry: 4g92 (more details), 1.8 Å

PDB Description: CCAAT-binding complex from Aspergillus nidulans with DNA
PDB Compounds: (B:) Transcription factor HapC (Eurofung)

SCOPe Domain Sequences for d4g92b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4g92b_ a.22.1.3 (B:) automated matches {Aspergillus nidulans [TaxId: 227321]}
mkeqdrwlpianvarimklalpenakiakeakecmqecvsefisfitseasekcqqekrk
tvngedilfamtslgfenyaealkiylskyre

SCOPe Domain Coordinates for d4g92b_:

Click to download the PDB-style file with coordinates for d4g92b_.
(The format of our PDB-style files is described here.)

Timeline for d4g92b_: