Lineage for d4g88h1 (4g88 H:221-339)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. Superfamily d.79.7: OmpA-like [103088] (2 families) (S)
  5. Family d.79.7.0: automated matches [195454] (1 protein)
    not a true family
  6. Protein automated matches [195455] (14 species)
    not a true protein
  7. Species Acinetobacter baumannii [TaxId:470] [224937] (5 PDB entries)
  8. Domain d4g88h1: 4g88 H:221-339 [221767]
    Other proteins in same PDB: d4g88a2, d4g88b2, d4g88c2, d4g88d2, d4g88e2, d4g88f2, d4g88g2, d4g88h2
    automated match to d2hqsc_
    complexed with api, srt

Details for d4g88h1

PDB Entry: 4g88 (more details), 1.7000000000000002 Å

PDB Description: crystal structure of ompa peptidoglycan-binding domain from acinetobacter baumannii
PDB Compounds: (H:) Outer membrane protein omp38

SCOPe Domain Sequences for d4g88h1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4g88h1 d.79.7.0 (H:221-339) automated matches {Acinetobacter baumannii [TaxId: 470]}
eltedlnmelrvffdtnksnikdqykpeiakvaeklseypnatarieghtdntgprklne
rlslaransvksalvneynvdasrlstqgfawdqpiadnktkegramnrrvfatitgsr

SCOPe Domain Coordinates for d4g88h1 are not available.

Timeline for d4g88h1:

Domains from same chain:
(mouse over for more information)
d4g88h2
Domains from other chains:
(mouse over for more information)
d4g88a1, d4g88a2, d4g88b1, d4g88b2, d4g88c1, d4g88c2, d4g88d1, d4g88d2, d4g88e1, d4g88e2, d4g88f1, d4g88f2, d4g88g1, d4g88g2