Lineage for d4g4wa_ (4g4w A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2958618Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2960608Superfamily d.79.7: OmpA-like [103088] (2 families) (S)
  5. 2960634Family d.79.7.0: automated matches [195454] (1 protein)
    not a true family
  6. 2960635Protein automated matches [195455] (14 species)
    not a true protein
  7. 2960677Species Acinetobacter baumannii [TaxId:980514] [226730] (3 PDB entries)
  8. 2960679Domain d4g4wa_: 4g4w A: [221706]
    automated match to d4erhb_
    complexed with ala, gol, so4

Details for d4g4wa_

PDB Entry: 4g4w (more details), 1.9 Å

PDB Description: crystal structure of peptidoglycan-associated lipoprotein from acinetobacter baumannii
PDB Compounds: (A:) peptidoglycan-associated lipoprotein

SCOPe Domain Sequences for d4g4wa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4g4wa_ d.79.7.0 (A:) automated matches {Acinetobacter baumannii [TaxId: 980514]}
akrvvhfdydssdlstedyqtlqahaqflmananskvaltghtdergtreynmalgerra
kavqnylitsgvnpqqleavsygkeapvnpghdesawkenrrveinye

SCOPe Domain Coordinates for d4g4wa_:

Click to download the PDB-style file with coordinates for d4g4wa_.
(The format of our PDB-style files is described here.)

Timeline for d4g4wa_: