Lineage for d4g2ea_ (4g2e A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1852416Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 1852417Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 1854430Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 1854431Protein automated matches [190056] (147 species)
    not a true protein
  7. 1855507Species Sulfolobus tokodaii [TaxId:273063] [193434] (2 PDB entries)
  8. 1855508Domain d4g2ea_: 4g2e A: [193435]
    automated match to d3hjpa_

Details for d4g2ea_

PDB Entry: 4g2e (more details), 1.4 Å

PDB Description: Crystal structure of a dimeric PrxQ from Sulfolobus tokodaii
PDB Compounds: (A:) peroxiredoxin

SCOPe Domain Sequences for d4g2ea_:

Sequence, based on SEQRES records: (download)

>d4g2ea_ c.47.1.0 (A:) automated matches {Sulfolobus tokodaii [TaxId: 273063]}
ghmveigelapdfelpdtelkkvklsalkgkvvvlafypaaftqvctkemctfrdsmakf
nqvnavvlgisvdppfsnkafkehnklnftilsdynrevvkkynvawefpalpgyvlakr
avfvidkegkvrykwvsddptkeppydeiekvvksls

Sequence, based on observed residues (ATOM records): (download)

>d4g2ea_ c.47.1.0 (A:) automated matches {Sulfolobus tokodaii [TaxId: 273063]}
ghmveigelapdfelpdtelkkvklsalkgkvvvlafypaaftqvtfrdsmakfnqvnav
vlgisvdppfsnkafkehnklnftilsdynrevvkkynvawefpalpgyvlakravfvid
kegkvrykwvsddptkeppydeiekvvksls

SCOPe Domain Coordinates for d4g2ea_:

Click to download the PDB-style file with coordinates for d4g2ea_.
(The format of our PDB-style files is described here.)

Timeline for d4g2ea_: