Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
Protein automated matches [190056] (147 species) not a true protein |
Species Sulfolobus tokodaii [TaxId:273063] [193434] (2 PDB entries) |
Domain d4g2ea_: 4g2e A: [193435] automated match to d3hjpa_ |
PDB Entry: 4g2e (more details), 1.4 Å
SCOPe Domain Sequences for d4g2ea_:
Sequence, based on SEQRES records: (download)
>d4g2ea_ c.47.1.0 (A:) automated matches {Sulfolobus tokodaii [TaxId: 273063]} ghmveigelapdfelpdtelkkvklsalkgkvvvlafypaaftqvctkemctfrdsmakf nqvnavvlgisvdppfsnkafkehnklnftilsdynrevvkkynvawefpalpgyvlakr avfvidkegkvrykwvsddptkeppydeiekvvksls
>d4g2ea_ c.47.1.0 (A:) automated matches {Sulfolobus tokodaii [TaxId: 273063]} ghmveigelapdfelpdtelkkvklsalkgkvvvlafypaaftqvtfrdsmakfnqvnav vlgisvdppfsnkafkehnklnftilsdynrevvkkynvawefpalpgyvlakravfvid kegkvrykwvsddptkeppydeiekvvksls
Timeline for d4g2ea_: