Class b: All beta proteins [48724] (177 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.30: Zn aminopeptidase insert domain [254133] (2 families) same topology as (b.1.15.1) |
Family b.1.30.0: automated matches [254306] (1 protein) not a true family |
Protein automated matches [254707] (4 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [255965] (16 PDB entries) |
Domain d4fyta3: 4fyt A:549-636 [266285] Other proteins in same PDB: d4fyta1, d4fyta2, d4fyta4, d4fyta5 automated match to d4p8qa3 complexed with nag, so4, zn |
PDB Entry: 4fyt (more details), 1.85 Å
SCOPe Domain Sequences for d4fyta3:
Sequence; same for both SEQRES and ATOM records: (download)
>d4fyta3 b.1.30.0 (A:549-636) automated matches {Human (Homo sapiens) [TaxId: 9606]} fpvitvdtstgtlsqehflldpdsnvtrpsefnyvwivpitsirdgrqqqdywlidvraq ndlfstsgnewvllnlnvtgyyrvnyde
Timeline for d4fyta3:
View in 3D Domains from same chain: (mouse over for more information) d4fyta1, d4fyta2, d4fyta4, d4fyta5 |