Lineage for d4fylb1 (4fyl B:2-91)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3006182Fold d.204: Ribosome binding protein Y (YfiA homologue) [69753] (1 superfamily)
    beta-alpha-beta(3)-alpha; 2 layers; mixed sheet 1234, strand 3 is antiparallel to the rest
  4. 3006183Superfamily d.204.1: Ribosome binding protein Y (YfiA homologue) [69754] (2 families) (S)
    automatically mapped to Pfam PF02482
  5. 3006200Family d.204.1.0: automated matches [227270] (1 protein)
    not a true family
  6. 3006201Protein automated matches [227070] (6 species)
    not a true protein
  7. 3006217Species Vibrio cholerae [TaxId:666] [311381] (1 PDB entry)
  8. 3006219Domain d4fylb1: 4fyl B:2-91 [307394]
    Other proteins in same PDB: d4fyla2, d4fylb2
    automated match to d3v26x_
    complexed with 3co, cl, unl

Details for d4fylb1

PDB Entry: 4fyl (more details), 1.6 Å

PDB Description: High-resolution X-ray Structure of HPF from Vibrio Cholerae
PDB Compounds: (B:) Ribosome hibernation protein YhbH

SCOPe Domain Sequences for d4fylb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4fylb1 d.204.1.0 (B:2-91) automated matches {Vibrio cholerae [TaxId: 666]}
qiniqghhidltdsmqdyvhskfdklerffdhinhvqvilrveklrqiaeatlhvnqaei
hahaddenmyaaidslvdklvrqlnkhkek

SCOPe Domain Coordinates for d4fylb1:

Click to download the PDB-style file with coordinates for d4fylb1.
(The format of our PDB-style files is described here.)

Timeline for d4fylb1:

3006219
d4fylb1 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d4fylb2