Lineage for d4fx6n_ (4fx6 N:)
- Root: SCOPe 2.03
Class c: Alpha and beta proteins (a/b) [51349] (147 folds) Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
the first seven superfamilies have similar phosphate-binding sites
Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) 
Family c.1.2.3: Decarboxylase [51375] (4 proteins) Protein automated matches [190130] (11 species)
not a true proteinSpecies Methanothermobacter thermautotrophicus [TaxId:187420] [188934] (66 PDB entries) 
Domain d4fx6n_: 4fx6 N: [193057]
automated match to d3li0a_
complexed with bmp, gol; mutant
Details for d4fx6n_
PDB Entry: 4fx6 (more details), 1.53 Å
PDB Description: Crystal structure of the mutant V182A.R203A of orotidine 5'-monophosphate decarboxylase from Methanobacterium thermoautotrophicum complexed with inhibitor BMP
PDB Compounds: (N:) orotidine 5'-phosphate decarboxylaseSCOPe Domain Sequences for d4fx6n_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4fx6n_ c.1.2.3 (N:) automated matches {Methanothermobacter thermautotrophicus [TaxId: 187420]}
srrvdvmdvmnrlilamdlmnrddalrvtgevreyidtvkigyplvlsegmdiiaefrkr
fgcriiadfkvadipetnekicratfkagadaiivhgfpgadsvraclnvaeemgrevfl
ltemshpgaemfiqgaadeiarmgvdlgvknyvgpstrperlsrlreiigqdsflispga
gaqggdpgetlrfadaiivgasiyladnpaaaaagiiesikdllnp
SCOPe Domain Coordinates for d4fx6n_:
Click to download the PDB-style file with coordinates for d4fx6n_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4fx6n_:
- d4fx6n_ first appeared in SCOPe 2.02
- d4fx6n_ appears in SCOPe 2.04
- d4fx6n_ appears in the current release, SCOPe 2.08
View in 3D
