Lineage for d4futa_ (4fut A:)

  1. Root: SCOPe 2.08
  2. Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. Fold e.23: Acetyl-CoA synthetase-like [56800] (1 superfamily)
    4 domains: (1&2) duplication: share the same alpha/beta fold; (3) beta-barrel; (4) alpha+beta
  4. Superfamily e.23.1: Acetyl-CoA synthetase-like [56801] (2 families) (S)
  5. Family e.23.1.0: automated matches [191594] (1 protein)
    not a true family
  6. Protein automated matches [191083] (32 species)
    not a true protein
  7. Species Rhodopseudomonas palustris [TaxId:258594] [226421] (2 PDB entries)
  8. Domain d4futa_: 4fut A: [221543]
    automated match to d2qvzx_
    complexed with atp, gol, mg

Details for d4futa_

PDB Entry: 4fut (more details), 2 Å

PDB Description: Crystal structure of ATP bound MatB from Rhodopseudomonas palustris
PDB Compounds: (A:) Malonyl CoA synthetase

SCOPe Domain Sequences for d4futa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4futa_ e.23.1.0 (A:) automated matches {Rhodopseudomonas palustris [TaxId: 258594]}
mnanlfarlfdklddphklaietaagdkisyaelvaragrvanvlvarglqvgdrvaaqt
eksvealvlylatvraggvylplntaytlheldyfitdaepkivvcdpskrdgiaaiaak
vgatvetlgpdgrgsltdaaagaseafatidrgaddlaailytsgttgrskgamlshdnl
asnsltlvdywrftpddvlihalpiyhthglfvasnvtlfargsmiflpkfdpdkildlm
aratvlmgvptfytrllqsprltkettghmrlfisgsaplladthrewsaktghavlery
gmtetnmntsnpydgdrvpgavgpalpgvsarvtdpetgkelprgdigmievkgpnvfkg
ywrmpektksefrddgffitgdlgkidergyvhilgrgkdlvitggfnvypkeieseida
mpgvvesavigvphadfgegvtavvvrdkgatideaqvlhgldgqlakfkmpkkvifvdd
lprntmgavqknvlretykdiyk

SCOPe Domain Coordinates for d4futa_ are not available.

Timeline for d4futa_: