![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.8: Urease, gamma-subunit [54110] (1 superfamily) alpha(3)-beta(2); antiparallel hairpin |
![]() | Superfamily d.8.1: Urease, gamma-subunit [54111] (2 families) ![]() |
![]() | Family d.8.1.0: automated matches [193589] (1 protein) not a true family |
![]() | Protein automated matches [193590] (3 species) not a true protein |
![]() | Species Brucella melitensis [TaxId:359391] [193591] (1 PDB entry) |
![]() | Domain d4furd_: 4fur D: [193592] automated match to d1ejxa_ complexed with cl, edo |
PDB Entry: 4fur (more details), 2.1 Å
SCOPe Domain Sequences for d4furd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4furd_ d.8.1.0 (D:) automated matches {Brucella melitensis [TaxId: 359391]} mhltprefdklvihmlsdvalkrknkglklnhpeavavlsayvldgaregktveevmdga rsvlkaddvmdgvpdllpliqveavfsdgsrlvslhnpit
Timeline for d4furd_: