Details for d4fpie_

PDB Entry: 4fpi (more details), 2.2 Å

PDB Compounds: (E:) 5-chloromuconolactone dehalogenase

SCOPe Domain Sequences for d4fpie_:

Sequence, based on SEQRES records: (download)

>d4fpie_ d.58.4.0 (E:) automated matches {Rhodococcus opacus [TaxId: 37919]}
mlylvrmtvnlprnldsreeerlkasekarsrtlqeqgqwrylwrttgkygnisvfdvns
hdelheilwslpffpyltidveplshhparvgkd

Sequence, based on observed residues (ATOM records): (download)

>d4fpie_ d.58.4.0 (E:) automated matches {Rhodococcus opacus [TaxId: 37919]}
mlylvrmtvnlprnleerlkasekarsrtlqeqgqwrylwrttgkygnisvfdvnshdel
heilwslpffpyltidveplshhparvgkd

SCOPe Domain Coordinates for d4fpie_:

Timeline for d4fpie_:

• d4fpie_ first appeared in SCOPe 2.02
  
• d4fpie_ appears in SCOPe 2.04
  
• d4fpie_ appears in SCOPe 2.06
  
• d4fpie_ appears in the current release, SCOPe 2.08
  

Thumbnails for d4fpie_:

d4fpie_ (click for larger image) View in 3D

d4fpie_ in context of PDB d4fpia_ in context of PDB d4fpib_ in context of PDB d4fpic_ in context of PDB d4fpid_ in context of PDB d4fpif_ in context of PDB d4fpig_ in context of PDB d4fpih_ in context of PDB d4fpii_ in context of PDB d4fpij_ in context of PDB d4fpik_ in context of PDB d4fpil_ in context of PDB d4fpim_ in context of PDB d4fpin_ in context of PDB d4fpio_ in context of PDB d4fpip_ in context of PDB d4fpir_ in context of PDB d4fpis_ in context of PDB d4fpit_ in context of PDB d4fpiu_ in context of PDB View in 3D Domains from other chains: (mouse over for more information) d4fpia_, d4fpib_, d4fpic_, d4fpid_, d4fpif_, d4fpig_, d4fpih_, d4fpii_, d4fpij_, d4fpik_, d4fpil_, d4fpim_, d4fpin_, d4fpio_, d4fpip_, d4fpir_, d4fpis_, d4fpit_, d4fpiu_