Lineage for d4fp8a_ (4fp8 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2775473Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2775474Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2775521Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)
  6. 2775522Protein Hemagglutinin [49824] (22 species)
    includes rudiment esterase domain
  7. 2775631Species Influenza A virus, different strains [TaxId:11320] [49825] (131 PDB entries)
  8. 2775830Domain d4fp8a_: 4fp8 A: [221421]
    Other proteins in same PDB: d4fp8h_, d4fp8i_, d4fp8j_, d4fp8k_, d4fp8l1, d4fp8l2, d4fp8m1, d4fp8m2, d4fp8n1, d4fp8n2, d4fp8o1, d4fp8o2
    automated match to d2visc_
    complexed with nag, zn

Details for d4fp8a_

PDB Entry: 4fp8 (more details), 2.95 Å

PDB Description: crystal structure of broadly neutralizing antibody c05 bound to h3 influenza hemagglutinin, ha1 subunit
PDB Compounds: (A:) Hemagglutinin HA1 chain

SCOPe Domain Sequences for d4fp8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4fp8a_ b.19.1.2 (A:) Hemagglutinin {Influenza A virus, different strains [TaxId: 11320]}
vqssstgkicnnphrildgidctlidallgdphcdvfqnetwdlfverskafsncypydv
pdyaslrslvassgtlefitegftwtgvtqnggsnackrgpgsgffsrlnwltksgstyp
vlnvtmpnndnfdklyiwgvhhpstnqeqtslyvqasgrvtvstrrsqqtiipnigsrpw
vrglssrisiywtivkpgdvlvinsngnliaprgyfkmrtgkssimrsdapidtciseci
tpngsipndkpfqnvnkitygacpkyv

SCOPe Domain Coordinates for d4fp8a_:

Click to download the PDB-style file with coordinates for d4fp8a_.
(The format of our PDB-style files is described here.)

Timeline for d4fp8a_: