Lineage for d4fm4j_ (4fm4 J:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2053585Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2054490Superfamily b.34.4: Electron transport accessory proteins [50090] (5 families) (S)
  5. 2054583Family b.34.4.0: automated matches [191659] (1 protein)
    not a true family
  6. 2054584Protein automated matches [191237] (4 species)
    not a true protein
  7. 2054585Species Comamonas testosteroni [TaxId:285] [193572] (4 PDB entries)
  8. 2054590Domain d4fm4j_: 4fm4 J: [193573]
    Other proteins in same PDB: d4fm4a_, d4fm4c_, d4fm4e_, d4fm4g_, d4fm4i_, d4fm4k_, d4fm4m_, d4fm4o_
    automated match to d3a8gb_
    complexed with fe, po4

Details for d4fm4j_

PDB Entry: 4fm4 (more details), 2.38 Å

PDB Description: Wild Type Fe-type Nitrile Hydratase from Comamonas testosteroni Ni1
PDB Compounds: (J:) Nitrile hydratase beta subunit

SCOPe Domain Sequences for d4fm4j_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4fm4j_ b.34.4.0 (J:) automated matches {Comamonas testosteroni [TaxId: 285]}
mdgmhdlggkqgfgpvikthnakafheewevkmnaisgalvskgiynmdeyrhgiermep
rhyltasyfervfttavtlciekgvftaaeleaklgtsvplslpsspgrqpakgpeggfk
lgqrvhvknefvpghtrfpayirgkagvvvgispaypypdaaahgeygfseptydvcfks
kdlwpdgceaadvhvgvfqsyllsae

SCOPe Domain Coordinates for d4fm4j_:

Click to download the PDB-style file with coordinates for d4fm4j_.
(The format of our PDB-style files is described here.)

Timeline for d4fm4j_: