Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.87: UDP-Glycosyltransferase/glycogen phosphorylase [53755] (1 superfamily) consists of two non-similar domains with 3 layers (a/b/a) each domain 1: parallel beta-sheet of 7 strands, order 3214567 domain 2: parallel beta-sheet of 6 strands, order 321456 |
Superfamily c.87.1: UDP-Glycosyltransferase/glycogen phosphorylase [53756] (13 families) |
Family c.87.1.3: UDP-N-acetylglucosamine 2-epimerase [53763] (2 proteins) automatically mapped to Pfam PF02350 |
Protein automated matches [197010] (3 species) not a true protein |
Species Bacillus subtilis [TaxId:224308] [197011] (1 PDB entry) |
Domain d4fkza_: 4fkz A: [197012] automated match to d1o6cb_ complexed with ud1, udp |
PDB Entry: 4fkz (more details), 1.69 Å
SCOPe Domain Sequences for d4fkza_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4fkza_ c.87.1.3 (A:) automated matches {Bacillus subtilis [TaxId: 224308]} kklkvmtvfgtrpeaikmaplvlelkkypeidsyvtvtaqhrqmldqvldafhikpdfdl nimkerqtlaeitsnalvrldelfkdikpdivlvhgdttttfagslaafyhqiavghvea glrtgnkyspfpeelnrqmtgaiadlhfaptgqakdnllkenkkadsifvtgntaidaln ttvrdgyshpvldqvgedkmilltahrrenlgepmenmfkairrivgefedvqvvypvhl npvvreaahkhfgdsdrvhlieplevidfhnfaakshfiltdsggvqeeapslgkpvlvl rdtterpegveagtlklagtdeeniyqlakqlltdpdeykkmsqasnpygdgeasrrive ellfhygyrkeqpdsftgklehhh
Timeline for d4fkza_: