Lineage for d4fkza_ (4fkz A:)
- Root: SCOPe 2.05
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.87: UDP-Glycosyltransferase/glycogen phosphorylase [53755] (1 superfamily)
consists of two non-similar domains with 3 layers (a/b/a) each
domain 1: parallel beta-sheet of 7 strands, order 3214567
domain 2: parallel beta-sheet of 6 strands, order 321456Superfamily c.87.1: UDP-Glycosyltransferase/glycogen phosphorylase [53756] (13 families) 
Family c.87.1.3: UDP-N-acetylglucosamine 2-epimerase [53763] (2 proteins)
automatically mapped to Pfam PF02350Protein automated matches [197010] (3 species)
not a true proteinSpecies Bacillus subtilis [TaxId:224308] [197011] (1 PDB entry) 
Domain d4fkza_: 4fkz A: [197012]
automated match to d1o6cb_
complexed with ud1, udp
Details for d4fkza_
PDB Entry: 4fkz (more details), 1.69 Å
PDB Description: Crystal structure of Bacillus subtilis UDP-GlcNAc 2-epimerase in complex with UDP-GlcNAc and UDP
PDB Compounds: (A:) udp-n-acetylglucosamine 2-epimeraseSCOPe Domain Sequences for d4fkza_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4fkza_ c.87.1.3 (A:) automated matches {Bacillus subtilis [TaxId: 224308]}
kklkvmtvfgtrpeaikmaplvlelkkypeidsyvtvtaqhrqmldqvldafhikpdfdl
nimkerqtlaeitsnalvrldelfkdikpdivlvhgdttttfagslaafyhqiavghvea
glrtgnkyspfpeelnrqmtgaiadlhfaptgqakdnllkenkkadsifvtgntaidaln
ttvrdgyshpvldqvgedkmilltahrrenlgepmenmfkairrivgefedvqvvypvhl
npvvreaahkhfgdsdrvhlieplevidfhnfaakshfiltdsggvqeeapslgkpvlvl
rdtterpegveagtlklagtdeeniyqlakqlltdpdeykkmsqasnpygdgeasrrive
ellfhygyrkeqpdsftgklehhh
SCOPe Domain Coordinates for d4fkza_:
Click to download the PDB-style file with coordinates for d4fkza_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4fkza_:
- d4fkza_ first appeared in SCOPe 2.02
- d4fkza_ appears in SCOPe 2.04
- d4fkza_ is called d4fkza1 in SCOPe 2.06
- d4fkza_ appears in the current release, SCOPe 2.08, called d4fkza1
View in 3D
