Lineage for d4fh8d_ (4fh8 D:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1852416Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 1852417Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 1853530Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins)
  6. 1853871Protein automated matches [190100] (17 species)
    not a true protein
  7. 1853973Species Ancylostoma ceylanicum [TaxId:53326] [197299] (2 PDB entries)
  8. 1853977Domain d4fh8d_: 4fh8 D: [197301]
    automated match to d1qmva_

Details for d4fh8d_

PDB Entry: 4fh8 (more details), 2.11 Å

PDB Description: Crystal Structure of Peroxiredoxin-1 from the human hookworm Ancylostoma ceylanicum
PDB Compounds: (D:) AcePrx-1

SCOPe Domain Sequences for d4fh8d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4fh8d_ c.47.1.10 (D:) automated matches {Ancylostoma ceylanicum [TaxId: 53326]}
hmskafigkpapdfatkavfdgdfvdvklsdykgkyvvlffypldftfvcpteiiafsdr
fpefknlnvavlacstdsvfshlawintprkhgglgdmkipvladtnhqiakdygvlkdd
egiayrglfiidpkgilrqitindlpvgrsvdetlrlvqafqytdkhgevc

SCOPe Domain Coordinates for d4fh8d_:

Click to download the PDB-style file with coordinates for d4fh8d_.
(The format of our PDB-style files is described here.)

Timeline for d4fh8d_: