Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
Protein automated matches [190069] (203 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [232746] (4 PDB entries) |
Domain d4fgwa1: 4fgw A:33-234 [234424] Other proteins in same PDB: d4fgwa2, d4fgwb2 automated match to d1wpqa1 |
PDB Entry: 4fgw (more details), 2.45 Å
SCOPe Domain Sequences for d4fgwa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4fgwa1 c.2.1.0 (A:33-234) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} kpfkvtvigsgnwgttiakvvaenckgypevfapivqmwvfeeeingeklteiintrhqn vkylpgitlpdnlvanpdlidsvkdvdiivfniphqflpricsqlkghvdshvraisclk gfevgakgvqllssyiteelgiqcgalsganiatevaqehwsettvayhipkdfrgegkd vdhkvlkalfhrpyfhvsvied
Timeline for d4fgwa1: