Lineage for d4f82b_ (4f82 B:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1852416Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 1852417Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 1854430Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 1854431Protein automated matches [190056] (147 species)
    not a true protein
  7. 1854745Species Burkholderia cenocepacia [TaxId:216591] [195045] (2 PDB entries)
  8. 1854747Domain d4f82b_: 4f82 B: [195046]
    automated match to d1tp9a1

Details for d4f82b_

PDB Entry: 4f82 (more details), 1.85 Å

PDB Description: X-ray crystal structure of a putative thioredoxin reductase from Burkholderia cenocepacia
PDB Compounds: (B:) thioredoxin reductase

SCOPe Domain Sequences for d4f82b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4f82b_ c.47.1.0 (B:) automated matches {Burkholderia cenocepacia [TaxId: 216591]}
hmiqvgdalpdaqlfefiddaregctlgpnacsvrdqvagkrvvifglpgaftptcsaqh
vpgyvehaeqlraagideiwcvsvndafvmgawgrdlhtagkvrmmadgsaafthalglt
qdlsargmgirslryamvidggvvktlaveapgkfevsdaasvlatlts

SCOPe Domain Coordinates for d4f82b_:

Click to download the PDB-style file with coordinates for d4f82b_.
(The format of our PDB-style files is described here.)

Timeline for d4f82b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4f82a_