Lineage for d4f6ga_ (4f6g A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2299347Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2299348Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2302832Family a.1.1.4: Nerve tissue mini-hemoglobin (neural globin) [74660] (2 proteins)
    lack the first helix but otherwise is more similar to conventional globins than the truncated ones
    automatically mapped to Pfam PF00042
  6. 2302833Protein Nerve tissue mini-hemoglobin (neural globin) [74661] (1 species)
  7. 2302834Species Milky ribbon worm (Cerebratulus lacteus) [TaxId:6221] [74662] (13 PDB entries)
    Uniprot O76242
  8. 2302842Domain d4f6ga_: 4f6g A: [195266]
    automated match to d2xkia_
    complexed with gol, hem, so4

Details for d4f6ga_

PDB Entry: 4f6g (more details), 1.64 Å

PDB Description: aquomet structure of his100trp cerebratulus lacteus mini-hemoglobin
PDB Compounds: (A:) neural hemoglobin

SCOPe Domain Sequences for d4f6ga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4f6ga_ a.1.1.4 (A:) Nerve tissue mini-hemoglobin (neural globin) {Milky ribbon worm (Cerebratulus lacteus) [TaxId: 6221]}
mvnwaavvddfyqelfkahpeyqnkfgfkgvalgslkgnaayktqagktvdyinaaiggs
adaaglasrhkgrnvgsaefhnakaclakacsahgapdlgwaiddilshl

SCOPe Domain Coordinates for d4f6ga_:

Click to download the PDB-style file with coordinates for d4f6ga_.
(The format of our PDB-style files is described here.)

Timeline for d4f6ga_: