Lineage for d4f65a_ (4f65 A:)
- Root: SCOPe 2.05
Class d: Alpha and beta proteins (a+b) [53931] (381 folds) 
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
consists of two alpha+beta domains, C-terminal domain is mostly alpha helicalSuperfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) 
shares functional and structural similarities with the ATP-grasp fold and PIPK
Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
members organized in the groups and subfamiles specified by the comments
Protein Fibroblast growth factor receptor 1 [56158] (1 species)
PTK group; FGFR subfamily; membrane spanning protein tyrosine kinaseSpecies Human (Homo sapiens) [TaxId:9606] [56159] (29 PDB entries) 
Domain d4f65a_: 4f65 A: [221042]
automated match to d4f63a_
complexed with 0s9, edo, so4
Details for d4f65a_
PDB Entry: 4f65 (more details), 2.26 Å
PDB Description: Crystal structure of Human Fibroblast Growth Factor Receptor 1 Kinase domain in complex with compound 8
PDB Compounds: (A:) fibroblast growth factor receptor 1SCOPe Domain Sequences for d4f65a_:
Sequence, based on SEQRES records: (download)
>d4f65a_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]}
elpedprwelprdrlvlgkplgegafgqvvlaeaigldkdkpnrvtkvavkmlksdatek
dlsdlisememmkmigkhkniinllgactqdgplyviveyaskgnlreylqarrppgley
synpshnpeeqlsskdlvscayqvargmeylaskkcihrdlaarnvlvtednvmkiadfg
lardihhidyykkttngrlpvkwmapealfdriythqsdvwsfgvllweiftlggspypg
vpveelfkllkeghrmdkpsnctnelymmmrdcwhavpsqrptfkqlvedldrivaltsn
qe
Sequence, based on observed residues (ATOM records): (download)
>d4f65a_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]}
elpedprwelprdrlvlgkplgegafgqvvlaeaigldkpnrvtkvavkmlksdatekdl
sdlisememmkmigkhkniinllgactqdgplyviveyaskgnlreylqarrpppeeqls
skdlvscayqvargmeylaskkcihrdlaarnvlvtednvmkiadfyykkttngrlpvkw
mapealfdriythqsdvwsfgvllweiftlggspypgvpveelfkllkeghrmdkpsnct
nelymmmrdcwhavpsqrptfkqlvedldrivaltsnqe
SCOPe Domain Coordinates for d4f65a_:
Click to download the PDB-style file with coordinates for d4f65a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4f65a_:
- d4f65a_ first appeared in SCOPe 2.03
- d4f65a_ appears in SCOPe 2.04
- d4f65a_ appears in SCOPe 2.06
- d4f65a_ appears in the current release, SCOPe 2.08
View in 3D
