Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.387: STING C-terminal-like [254119] (1 superfamily) 5 helices and 5 strands in one mixed beta-sheet, one long bent helix |
Superfamily d.387.1: STING, TM173 CTD-like [254144] (2 families) Pfam PF15009, PubMed 22579474 |
Family d.387.1.1: Tyrosinase cofactor MelC1 [254191] (2 proteins) |
Protein Tyrosinase cofactor MelC1 [254420] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [254863] (48 PDB entries) |
Domain d4f5wa_: 4f5w A: [251900] automated match to d4ef5a_ complexed with ca |
PDB Entry: 4f5w (more details), 2.2 Å
SCOPe Domain Sequences for d4f5wa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4f5wa_ d.387.1.1 (A:) Tyrosinase cofactor MelC1 {Human (Homo sapiens) [TaxId: 9606]} gnfnvahglawsyyigylrlilpelqarirtynqhynnllrgavsqrlyillpldcgvpd nlsmadpnirfldklpqqtgdragikdrvysnsiyellengqragtcvleyatplqtlfa msqysqagfsredrleqaklfcrtlediladapesqnncrliayqepaddssfslsqevl rhlrqeekeevtv
Timeline for d4f5wa_: