Lineage for d4f5wa_ (4f5w A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3011892Fold d.387: STING C-terminal-like [254119] (1 superfamily)
    5 helices and 5 strands in one mixed beta-sheet, one long bent helix
  4. 3011893Superfamily d.387.1: STING, TM173 CTD-like [254144] (2 families) (S)
    Pfam PF15009, PubMed 22579474
  5. 3011894Family d.387.1.1: Tyrosinase cofactor MelC1 [254191] (2 proteins)
  6. 3011895Protein Tyrosinase cofactor MelC1 [254420] (1 species)
  7. 3011896Species Human (Homo sapiens) [TaxId:9606] [254863] (48 PDB entries)
  8. 3011927Domain d4f5wa_: 4f5w A: [251900]
    automated match to d4ef5a_
    complexed with ca

Details for d4f5wa_

PDB Entry: 4f5w (more details), 2.2 Å

PDB Description: Crystal structure of ligand free human STING CTD
PDB Compounds: (A:) Transmembrane protein 173

SCOPe Domain Sequences for d4f5wa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4f5wa_ d.387.1.1 (A:) Tyrosinase cofactor MelC1 {Human (Homo sapiens) [TaxId: 9606]}
gnfnvahglawsyyigylrlilpelqarirtynqhynnllrgavsqrlyillpldcgvpd
nlsmadpnirfldklpqqtgdragikdrvysnsiyellengqragtcvleyatplqtlfa
msqysqagfsredrleqaklfcrtlediladapesqnncrliayqepaddssfslsqevl
rhlrqeekeevtv

SCOPe Domain Coordinates for d4f5wa_:

Click to download the PDB-style file with coordinates for d4f5wa_.
(The format of our PDB-style files is described here.)

Timeline for d4f5wa_: