Lineage for d4f5fa_ (4f5f A:)
- Root: SCOPe 2.05
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the restSuperfamily c.67.1: PLP-dependent transferases [53383] (10 families) 
Family c.67.1.1: AAT-like [53384] (17 proteins) Protein automated matches [190317] (4 species)
not a true proteinSpecies Escherichia coli K-12 [TaxId:83333] [196886] (8 PDB entries) 
Domain d4f5fa_: 4f5f A: [196888]
automated match to d1aama_
Details for d4f5fa_
PDB Entry: 4f5f (more details), 2.25 Å
PDB Description: Structure of Aspartate Aminotransferase Conversion to Tyrosine Aminotransferase: Chimera P1.
PDB Compounds: (A:) aspartate aminotransferaseSCOPe Domain Sequences for d4f5fa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4f5fa_ c.67.1.1 (A:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
hvgtfenitaapadpilgladlfraderpgkvdlgvgvykdetgktpvltsvkkaeqyll
enettktylgldglpefgrctqellfgkgsalindkrartaqtpggsgalrvgadflakn
tsvkrvwvsnpswpnhkaifnsaglevreyayydaenhtldfdalinslneaqagdvvlf
hgcchnptgidptleqwqtlaqlsvekgwlplidfayqgfgrgleedaeglrafaamhke
livassysknfglynervgactlvaadsetvdrafsqmkaairanysnppahgasvvati
lsndalraiweqeltdmrqriqrmrqlfvntlqekganrdfsfiikqngmfsfsgltkeq
vlrlreefgvyavasgrinvagmtpdnmaplceaivavl
SCOPe Domain Coordinates for d4f5fa_:
Click to download the PDB-style file with coordinates for d4f5fa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4f5fa_:
- d4f5fa_ first appeared in SCOPe 2.02
- d4f5fa_ appears in SCOPe 2.04
- d4f5fa_ is called d4f5fa1 in SCOPe 2.06
- d4f5fa_ appears in the current release, SCOPe 2.08, called d4f5fa1
View in 3D
